Commit 2c682439 authored by Marek Szuba's avatar Marek Szuba

Synchronise test databases with their counterparts from ensembl

This updates the core test DBs from 90 to 100 and the compara one from
90 to 99. Moreover, we now actually have SQLite test DBs instead of
empty directories.
parent 26dafa5a
......@@ -34,3 +34,4 @@
8406 2009-06-01 09:01:22 xrefexoneratedna NULL NULL NULL NULL NULL NULL NULL NULL NULL NULL NULL
8407 2007-09-07 12:01:22 est2genome_human_havana NULL 10-Nov-10 (105) NULL NULL NULL NULL ori_analysis => Est2genome_human_raw, mode => single ClusterDepthFilter NULL EST_Human similarity
8408 2007-09-07 12:01:22 uniprot_sw_havana NULL 2010_11 NULL NULL NULL NULL percentid_cutoff => 40, ori_analysis => Uniprot_raw, hit_db => Swissprot, mode => single DepthFilter NULL SwissProt NULL
8409 2017-11-02 10:15:53 gifts_import GIFTS NULL NULL NULL NULL NULL NULL NULL NULL NULL NULL
\ No newline at end of file
......@@ -19,3 +19,6 @@
19 karyotype_rank Rank in the karyotype For a given seq_region, if it is part of the species karyotype, will indicate its rank
20 proj_parent_g projection parent gene Stable identifier of the parent gene this gene was projected from (projection between different species and/or assemblies).
21 proj_parent_t projection parent transcript Stable identifier of the parent transcript this transcript was projected from (projection between different species and/or assemblies).
22 mirna_arm miRNA arm Hairpin arm from which this miRNA has come from
23 _stop_codon_rt Stop Codon Readthrough \N
24 appris APPRIS \N
64 protein_coding gene core,otherfeatures,rnaseq,vega,presite \N \N coding SO:0001217 protein_coding_gene
65 protein_coding transcript core,otherfeatures,rnaseq,vega,presite \N \N coding SO:0000234 mRNA
87 tRNA gene core,otherfeatures,presite 76 \N snoncoding SO:0001263 ncRNA_gene
1 \N schema_version 90
1 \N schema_version 100
2 1 assembly.default NCBI34
3 1 species.taxonomy_id 9606
26 1 species.classification Homo sapiens
......@@ -89,3 +89,27 @@
156 \N patch patch_89_90_a.sql|schema_version
157 \N patch patch_89_90_b.sql|remove_status
158 \N patch patch_89_90_c.sql|pf_hit_name_case_sensitive
159 \N patch patch_90_91_a.sql|schema_version
160 \N patch patch_90_91_b.sql|align_type
161 \N patch patch_90_91_c.sql|protein_align_type
162 \N patch patch_90_91_d.sql|remove_external_data
163 \N patch patch_91_92_a.sql|schema_version
164 \N patch patch_91_92_b.sql|add_cigar_line_align_type
165 \N patch patch_92_93_a.sql|schema_version
166 \N patch patch_92_93_b.sql|biotype_table
167 \N patch patch_92_93_c.sql|collate_index_interpro
168 \N patch patch_93_94_a.sql|schema_version
169 \N patch patch_93_94_b.sql|nullable_ox_analysis
170 \N patch patch_93_94_c.sql|default_aln_type
171 \N patch patch_94_95_a.sql|schema_version
172 \N patch patch_94_95_b.sql|vertebrate_division_rename
173 \N patch patch_94_95_c.sql|ox_key_update
174 \N patch patch_95_96_a.sql|schema_version
175 \N patch patch_96_97_a.sql|schema_version
176 \N patch patch_96_97_b.sql|biotype_so_term
177 \N patch patch_96_97_c.sql|rnaproduct_tables
178 \N patch patch_96_97_d.sql|add_object_type_rnaproduct
179 \N patch patch_96_97_e.sql|add_stable_id_event_type_rnaproduct
180 \N patch patch_97_98_a.sql|schema_version
188 \N patch patch_98_99_a.sql|schema_version
189 \N patch patch_99_100_a.sql|schema_version
......@@ -203,3 +203,5 @@
253682 21727 Translation 168444 119 0
253683 21727 Translation 168445 119 0
253684 21727 Translation 168446 119 0
999998 1 RNAProduct 123456 \N 0
999999 2 RNAProduct 123457 \N 0
27374 21716 76 99 45 75 0 41 0.00 0 0 \N \N
217249 21716 47 151 49 79 PF000001 41 87.10 8.2e-25 0 \N \N
242732 21716 80 160 71 101 0 41 0.00 0.000000000032 0 \N \N
217179 21717 1 94 49 79 PF000019 41 99.10 3.3e-28 0 \N \N
242734 21717 3 91 71 101 0 41 0.00 0.0000000000000017 0 \N \N
217309 21718 76 201 49 79 PF000019 41 118.90 8.9e-34 0 \N \N
242735 21718 1 185 71 101 0 41 0.00 0.00000000000003 0 \N \N
27378 21719 90 117 45 75 0 41 0.00 0 0 \N \N
83043 21719 21 41 44 74 0 41 2.37 0 0 \N \N
242736 21719 76 124 71 101 0 41 0.00 0.0017 0 \N \N
24545 21720 79 101 46 76 0 41 0.00 0 0 \N \N
24546 21720 106 123 46 76 0 41 0.00 0 0 \N \N
24547 21720 138 155 46 76 0 41 0.00 0 0 \N \N
24548 21720 192 214 46 76 0 41 0.00 0 0 \N \N
83044 21720 37 59 44 74 0 41 2.67 0 0 \N \N
116148 21720 93 100 42 72 0 41 0.00 0 0 \N \N
83051 21721 24 37 44 74 0 41 2.30 0 0 \N \N
83052 21721 170 184 44 74 0 41 1.97 0 0 \N \N
83053 21721 212 235 44 74 0 41 2.47 0 0 \N \N
242779 21721 47 146 71 101 0 41 0.00 0.002 0 \N \N
83045 21722 135 149 44 74 0 41 1.97 0 0 \N \N
83046 21722 171 187 44 74 PF000001 41 1.66 0 0 \N \N
83047 21722 217 230 44 74 0 41 1.09 0 0 \N \N
83048 21722 361 376 44 74 0 41 2.44 0 0 \N \N
83049 21722 470 482 44 74 0 41 2.20 0 0 \N \N
83050 21722 512 520 44 74 0 41 0.76 0 0 \N \N
116149 21722 347 358 42 72 0 41 0.00 0 0 \N \N
116150 21723 268 290 42 72 0 41 1.00 0 0 \N \N
116151 21723 377 389 42 72 0 41 1.00 0 0 \N \N
130095 21723 144 241 41 71 0 41 26.88 0 0 \N \N
130097 21723 78 138 41 71 0 41 19.62 0 0 \N \N
161506 21723 144 158 40 70 0 41 394.00 0.00000981 0 \N \N
161508 21723 165 175 40 70 0 41 321.00 0.0000259 0 \N \N
161510 21723 177 188 40 70 0 41 288.00 0.00000103 0 \N \N
161512 21723 194 204 40 70 0 41 295.00 0.0000486 0 \N \N
161514 21723 215 229 40 70 0 41 349.00 0.0000007 0 \N \N
161516 21723 81 91 40 70 0 41 266.00 0.0000318 0 \N \N
161518 21723 95 110 40 70 0 41 334.00 0.000000138 0 \N \N
161520 21723 111 120 40 70 0 41 225.00 0.0222 0 \N \N
161522 21723 124 136 40 70 0 41 341.00 0.00000182 0 \N \N
161524 21723 83 103 40 70 0 41 565.00 0.00000000711 0 \N \N
161526 21723 103 119 40 70 0 41 188.00 0.099 0 \N \N
217502 21723 83 138 49 79 58 41 98.90 6.4e-27 0 \N \N
217503 21723 146 228 49 79 79 41 150.90 1.5e-42 0 \N \N
217504 21723 264 513 49 79 294 41 260.80 1.2e-75 0 \N \N
242780 21723 244 526 71 101 0 41 0.00 2.3e-79 0 \N \N
242781 21723 138 282 71 101 0 41 0.00 1.3e-33 0 \N \N
242782 21723 81 162 71 101 0 41 0.00 2.5e-22 0 \N \N
24549 21724 263 285 46 76 0 41 0.00 0 0 \N \N
24550 21724 329 351 46 76 0 41 0.00 0 0 \N \N
24551 21724 361 383 46 76 0 41 0.00 0 0 \N \N
24552 21724 396 418 46 76 0 41 0.00 0 0 \N \N
24553 21724 433 455 46 76 0 41 0.00 0 0 \N \N
24554 21724 483 505 46 76 0 41 0.00 0 0 \N \N
24555 21724 515 537 46 76 0 41 0.00 0 0 \N \N
24556 21724 550 572 46 76 0 41 0.00 0 0 \N \N
24557 21724 587 609 46 76 0 41 0.00 0 0 \N \N
83054 21724 270 275 44 74 0 41 0.92 0 0 \N \N
83055 21724 326 335 44 74 0 41 1.97 0 0 \N \N
83056 21724 367 378 44 74 0 41 2.05 0 0 \N \N
83057 21724 513 529 44 74 0 41 2.42 0 0 \N \N
217569 21724 37 583 49 79 600 41 1244.70 0 0 \N \N
242783 21724 3 576 71 101 0 41 0.00 0.0058 0 \N \N
27431 21725 113 133 45 75 0 41 0.00 0 0 \N \N
83058 21725 30 40 44 74 0 41 1.87 0 0 \N \N
83059 21725 109 135 44 74 0 41 2.49 0 0 \N \N
217397 21725 146 331 49 79 324 41 84.50 1.4e-22 0 \N \N
83060 21726 369 397 44 74 0 41 2.53 0 0 \N \N
83061 21726 417 432 44 74 0 41 2.30 0 0 \N \N
83062 21726 443 458 44 74 0 41 2.43 0 0 \N \N
116152 21726 70 92 42 72 0 41 1.00 0 0 \N \N
116153 21726 100 120 42 72 0 41 1.00 0 0 \N \N
116154 21726 129 149 42 72 0 41 1.00 0 0 \N \N
116155 21726 158 178 42 72 0 41 1.00 0 0 \N \N
116156 21726 193 213 42 72 0 41 0.00 0 0 \N \N
116157 21726 221 242 42 72 0 41 1.00 0 0 \N \N
130099 21726 68 97 41 71 0 41 14.81 0 0 \N \N
130101 21726 98 125 41 71 0 41 11.68 0 0 \N \N
130103 21726 127 154 41 71 0 41 9.56 0 0 \N \N
130105 21726 156 183 41 71 0 41 9.54 0 0 \N \N
130107 21726 191 218 41 71 0 41 12.09 0 0 \N \N
130109 21726 219 247 41 71 0 41 11.28 0 0 \N \N
217476 21726 68 94 49 79 24 41 12.80 0.29 0 \N \N
217477 21726 100 122 49 79 24 41 25.30 0.000092 0 \N \N
217478 21726 129 151 49 79 24 41 19.70 0.0045 0 \N \N
217479 21726 158 180 49 79 24 41 19.20 0.0063 0 \N \N
217480 21726 193 215 49 79 24 41 22.90 0.00049 0 \N \N
217481 21726 221 244 49 79 24 41 24.00 0.00023 0 \N \N
242784 21726 80 124 71 101 0 41 0.00 0.0000000015 0 \N \N
242785 21726 205 245 71 101 0 41 0.00 0.0000000075 0 \N \N
242786 21726 58 85 71 101 0 41 0.00 0.0011 0 \N \N
34517 21727 1 26 43 73 0 41 0.00 0 0 \N \N
83063 21727 15 22 44 74 0 41 0.81 0 0 \N \N
34518 21728 1 26 43 73 0 41 0.00 0 0 \N \N
83064 21728 15 22 44 74 0 41 0.81 0 0 \N \N
27435 21729 355 375 45 75 0 41 0.00 0 0 \N \N
27437 21729 436 473 45 75 0 41 0.00 0 0 \N \N
27440 21729 482 519 45 75 0 41 0.00 0 0 \N \N
27443 21729 541 579 45 75 0 41 0.00 0 0 \N \N
83065 21729 6 17 44 74 0 41 2.13 0 0 \N \N
83066 21729 370 407 44 74 0 41 2.15 0 0 \N \N
83067 21729 437 458 44 74 0 41 2.44 0 0 \N \N
83068 21729 493 514 44 74 0 41 2.50 0 0 \N \N
83069 21729 537 548 44 74 0 41 1.90 0 0 \N \N
83070 21729 685 697 44 74 0 41 2.26 0 0 \N \N
83071 21729 711 735 44 74 0 41 2.42 0 0 \N \N
116158 21729 96 103 42 72 0 41 0.00 0 0 \N \N
116159 21729 239 250 42 72 0 41 1.00 0 0 \N \N
130111 21729 6 256 41 71 0 41 55.45 0 0 \N \N
161528 21729 87 108 40 70 0 41 911.00 4.44e-16 0 \N \N
161530 21729 206 223 40 70 0 41 585.00 0.000000000263 0 \N \N
161532 21729 240 258 40 70 0 41 576.00 0.00000000000836 0 \N \N
161534 21729 290 311 40 70 0 41 833.00 4.44e-16 0 \N \N
217672 21729 55 341 49 79 373 41 576.30 1.3e-170 0 \N \N
242791 21729 4 365 71 101 0 41 0.00 8.4e-131 0 \N \N
83072 21730 3 16 44 74 0 41 1.78 0 0 \N \N
83073 21730 140 153 44 74 0 41 2.15 0 0 \N \N
83074 21730 442 469 44 74 0 41 1.89 0 0 \N \N
83075 21730 644 654 44 74 0 41 1.87 0 0 \N \N
83076 21730 1221 1235 44 74 0 41 2.15 0 0 \N \N
83077 21730 1250 1264 44 74 0 41 2.20 0 0 \N \N
83078 21731 194 211 44 74 0 41 1.95 0 0 \N \N
83079 21731 335 348 44 74 0 41 2.15 0 0 \N \N
83080 21731 637 664 44 74 0 41 1.89 0 0 \N \N
83081 21731 839 849 44 74 0 41 1.87 0 0 \N \N
83082 21732 33 61 44 74 0 41 2.68 0 0 \N \N
83083 21732 161 178 44 74 0 41 1.83 0 0 \N \N
83084 21732 375 396 44 74 0 41 1.93 0 0 \N \N
116160 21732 92 102 42 72 0 41 0.00 0 0 \N \N
130113 21732 235 252 41 71 0 41 3.00 0 0 \N \N
83085 21735 76 95 44 74 0 41 2.54 0 0 \N \N
83086 21735 104 122 44 74 0 41 2.65 0 0 \N \N
83087 21736 5 20 44 74 0 41 1.92 0 0 \N \N
83088 21737 47 65 44 74 0 41 2.35 0 0 \N \N
83089 21737 72 83 44 74 0 41 1.65 0 0 \N \N
83090 21737 110 125 44 74 0 41 2.42 0 0 \N \N
83091 21737 142 154 44 74 0 41 2.16 0 0 \N \N
83092 21737 166 177 44 74 0 41 2.08 0 0 \N \N
83093 21737 565 576 44 74 0 41 1.96 0 0 \N \N
116161 21737 309 316 42 72 0 41 0.00 0 0 \N \N
116162 21737 643 655 42 72 0 41 0.00 0 0 \N \N
217810 21737 223 296 49 79 87 41 121.00 1.5e-33 0 \N \N
217811 21737 576 849 49 79 418 41 -74.00 0.0000085 0 \N \N
242841 21737 573 848 71 101 0 41 0.00 3e-50 0 \N \N
242842 21737 216 351 71 101 0 41 0.00 1.2e-41 0 \N \N
27455 21738 193 213 45 75 0 41 0.00 0 0 \N \N
83094 21738 256 267 44 74 0 41 2.12 0 0 \N \N
130115 21738 14 116 41 71 0 41 8.92 0 0 \N \N
217326 21738 15 117 49 79 106 41 28.00 0.000015 0 \N \N
217327 21738 210 257 49 79 56 41 106.00 4.7e-29 0 \N \N
242845 21738 13 115 71 101 0 41 0.00 3e-17 0 \N \N
83095 21739 44 56 44 74 0 41 2.19 0 0 \N \N
130117 21739 144 201 41 71 0 41 9.70 0 0 \N \N
217297 21739 141 168 49 79 29 41 4.40 1.7 0 \N \N
217298 21739 176 204 49 79 29 41 12.70 0.15 0 \N \N
242846 21739 117 207 71 101 0 41 0.00 0.0000000004 0 \N \N
27374 21716 76 99 45 75 0 41 0 0 0 \N \N \N \N
217249 21716 47 151 49 79 PF000001 41 87.1 8.2e-25 0 \N \N \N \N
242732 21716 80 160 71 101 0 41 0 0.000000000032 0 \N \N \N \N
217179 21717 1 94 49 79 PF000019 41 99.1 3.3e-28 0 \N \N \N \N
242734 21717 3 91 71 101 0 41 0 0.0000000000000017 0 \N \N \N \N
217309 21718 76 201 49 79 PF000019 41 118.9 8.9e-34 0 \N \N \N \N
242735 21718 1 185 71 101 0 41 0 0.00000000000003 0 \N \N \N \N
27378 21719 90 117 45 75 0 41 0 0 0 \N \N \N \N
83043 21719 21 41 44 74 0 41 2.37 0 0 \N \N \N \N
242736 21719 76 124 71 101 0 41 0 0.0017 0 \N \N \N \N
24545 21720 79 101 46 76 0 41 0 0 0 \N \N \N \N
24546 21720 106 123 46 76 0 41 0 0 0 \N \N \N \N
24547 21720 138 155 46 76 0 41 0 0 0 \N \N \N \N
24548 21720 192 214 46 76 0 41 0 0 0 \N \N \N \N
83044 21720 37 59 44 74 0 41 2.67 0 0 \N \N \N \N
116148 21720 93 100 42 72 0 41 0 0 0 \N \N \N \N
83051 21721 24 37 44 74 0 41 2.3 0 0 \N \N \N \N
83052 21721 170 184 44 74 0 41 1.97 0 0 \N \N \N \N
83053 21721 212 235 44 74 0 41 2.47 0 0 \N \N \N \N
242779 21721 47 146 71 101 0 41 0 0.002 0 \N \N \N \N
83045 21722 135 149 44 74 0 41 1.97 0 0 \N \N \N \N
83046 21722 171 187 44 74 PF000001 41 1.66 0 0 \N \N \N \N
83047 21722 217 230 44 74 0 41 1.09 0 0 \N \N \N \N
83048 21722 361 376 44 74 0 41 2.44 0 0 \N \N \N \N
83049 21722 470 482 44 74 0 41 2.2 0 0 \N \N \N \N
83050 21722 512 520 44 74 0 41 0.76 0 0 \N \N \N \N
116149 21722 347 358 42 72 0 41 0 0 0 \N \N \N \N
116150 21723 268 290 42 72 0 41 1 0 0 \N \N \N \N
116151 21723 377 389 42 72 0 41 1 0 0 \N \N \N \N
130095 21723 144 241 41 71 0 41 26.88 0 0 \N \N \N \N
130097 21723 78 138 41 71 0 41 19.62 0 0 \N \N \N \N
161506 21723 144 158 40 70 0 41 394 0.00000981 0 \N \N \N \N
161508 21723 165 175 40 70 0 41 321 0.0000259 0 \N \N \N \N
161510 21723 177 188 40 70 0 41 288 0.00000103 0 \N \N \N \N
161512 21723 194 204 40 70 0 41 295 0.0000486 0 \N \N \N \N
161514 21723 215 229 40 70 0 41 349 0.0000007 0 \N \N \N \N
161516 21723 81 91 40 70 0 41 266 0.0000318 0 \N \N \N \N
161518 21723 95 110 40 70 0 41 334 0.000000138 0 \N \N \N \N
161520 21723 111 120 40 70 0 41 225 0.0222 0 \N \N \N \N
161522 21723 124 136 40 70 0 41 341 0.00000182 0 \N \N \N \N
161524 21723 83 103 40 70 0 41 565 0.00000000711 0 \N \N \N \N
161526 21723 103 119 40 70 0 41 188 0.099 0 \N \N \N \N
217502 21723 83 138 49 79 58 41 98.9 6.4e-27 0 \N \N \N \N
217503 21723 146 228 49 79 79 41 150.9 1.5e-42 0 \N \N \N \N
217504 21723 264 513 49 79 294 41 260.8 1.2e-75 0 \N \N \N \N
242780 21723 244 526 71 101 0 41 0 2.3e-79 0 \N \N \N \N
242781 21723 138 282 71 101 0 41 0 1.3e-33 0 \N \N \N \N
242782 21723 81 162 71 101 0 41 0 2.5e-22 0 \N \N \N \N
24549 21724 263 285 46 76 0 41 0 0 0 \N \N \N \N
24550 21724 329 351 46 76 0 41 0 0 0 \N \N \N \N
24551 21724 361 383 46 76 0 41 0 0 0 \N \N \N \N
24552 21724 396 418 46 76 0 41 0 0 0 \N \N \N \N
24553 21724 433 455 46 76 0 41 0 0 0 \N \N \N \N
24554 21724 483 505 46 76 0 41 0 0 0 \N \N \N \N
24555 21724 515 537 46 76 0 41 0 0 0 \N \N \N \N
24556 21724 550 572 46 76 0 41 0 0 0 \N \N \N \N
24557 21724 587 609 46 76 0 41 0 0 0 \N \N \N \N
83054 21724 270 275 44 74 0 41 0.92 0 0 \N \N \N \N
83055 21724 326 335 44 74 0 41 1.97 0 0 \N \N \N \N
83056 21724 367 378 44 74 0 41 2.05 0 0 \N \N \N \N
83057 21724 513 529 44 74 0 41 2.42 0 0 \N \N \N \N
217569 21724 37 583 49 79 600 41 1244.7 0 0 \N \N \N \N
242783 21724 3 576 71 101 0 41 0 0.0058 0 \N \N \N \N
27431 21725 113 133 45 75 0 41 0 0 0 \N \N \N \N
83058 21725 30 40 44 74 0 41 1.87 0 0 \N \N \N \N
83059 21725 109 135 44 74 0 41 2.49 0 0 \N \N \N \N
217397 21725 146 331 49 79 324 41 84.5 1.4e-22 0 \N \N \N \N
83060 21726 369 397 44 74 0 41 2.53 0 0 \N \N \N \N
83061 21726 417 432 44 74 0 41 2.3 0 0 \N \N \N \N
83062 21726 443 458 44 74 0 41 2.43 0 0 \N \N \N \N
116152 21726 70 92 42 72 0 41 1 0 0 \N \N \N \N
116153 21726 100 120 42 72 0 41 1 0 0 \N \N \N \N
116154 21726 129 149 42 72 0 41 1 0 0 \N \N \N \N
116155 21726 158 178 42 72 0 41 1 0 0 \N \N \N \N
116156 21726 193 213 42 72 0 41 0 0 0 \N \N \N \N
116157 21726 221 242 42 72 0 41 1 0 0 \N \N \N \N
130099 21726 68 97 41 71 0 41 14.81 0 0 \N \N \N \N
130101 21726 98 125 41 71 0 41 11.68 0 0 \N \N \N \N
130103 21726 127 154 41 71 0 41 9.56 0 0 \N \N \N \N
130105 21726 156 183 41 71 0 41 9.54 0 0 \N \N \N \N
130107 21726 191 218 41 71 0 41 12.09 0 0 \N \N \N \N
130109 21726 219 247 41 71 0 41 11.28 0 0 \N \N \N \N
217476 21726 68 94 49 79 24 41 12.8 0.29 0 \N \N \N \N
217477 21726 100 122 49 79 24 41 25.3 0.000092 0 \N \N \N \N
217478 21726 129 151 49 79 24 41 19.7 0.0045 0 \N \N \N \N
217479 21726 158 180 49 79 24 41 19.2 0.0063 0 \N \N \N \N
217480 21726 193 215 49 79 24 41 22.9 0.00049 0 \N \N \N \N
217481 21726 221 244 49 79 24 41 24 0.00023 0 \N \N \N \N
242784 21726 80 124 71 101 0 41 0 0.0000000015 0 \N \N \N \N
242785 21726 205 245 71 101 0 41 0 0.0000000075 0 \N \N \N \N
242786 21726 58 85 71 101 0 41 0 0.0011 0 \N \N \N \N
34517 21727 1 26 43 73 0 41 0 0 0 \N \N \N \N
83063 21727 15 22 44 74 0 41 0.81 0 0 \N \N \N \N
34518 21728 1 26 43 73 0 41 0 0 0 \N \N \N \N
83064 21728 15 22 44 74 0 41 0.81 0 0 \N \N \N \N
27435 21729 355 375 45 75 0 41 0 0 0 \N \N \N \N
27437 21729 436 473 45 75 0 41 0 0 0 \N \N \N \N
27440 21729 482 519 45 75 0 41 0 0 0 \N \N \N \N
27443 21729 541 579 45 75 0 41 0 0 0 \N \N \N \N
83065 21729 6 17 44 74 0 41 2.13 0 0 \N \N \N \N
83066 21729 370 407 44 74 0 41 2.15 0 0 \N \N \N \N
83067 21729 437 458 44 74 0 41 2.44 0 0 \N \N \N \N
83068 21729 493 514 44 74 0 41 2.5 0 0 \N \N \N \N
83069 21729 537 548 44 74 0 41 1.9 0 0 \N \N \N \N
83070 21729 685 697 44 74 0 41 2.26 0 0 \N \N \N \N
83071 21729 711 735 44 74 0 41 2.42 0 0 \N \N \N \N
116158 21729 96 103 42 72 0 41 0 0 0 \N \N \N \N
116159 21729 239 250 42 72 0 41 1 0 0 \N \N \N \N
130111 21729 6 256 41 71 0 41 55.45 0 0 \N \N \N \N
161528 21729 87 108 40 70 0 41 911 4.44e-16 0 \N \N \N \N
161530 21729 206 223 40 70 0 41 585 0.000000000263 0 \N \N \N \N
161532 21729 240 258 40 70 0 41 576 0.00000000000836 0 \N \N \N \N
161534 21729 290 311 40 70 0 41 833 4.44e-16 0 \N \N \N \N
217672 21729 55 341 49 79 373 41 576.3 1.3e-170 0 \N \N \N \N
242791 21729 4 365 71 101 0 41 0 8.4e-131 0 \N \N \N \N
83072 21730 3 16 44 74 0 41 1.78 0 0 \N \N \N \N
83073 21730 140 153 44 74 0 41 2.15 0 0 \N \N \N \N
83074 21730 442 469 44 74 0 41 1.89 0 0 \N \N \N \N
83075 21730 644 654 44 74 0 41 1.87 0 0 \N \N \N \N
83076 21730 1221 1235 44 74 0 41 2.15 0 0 \N \N \N \N
83077 21730 1250 1264 44 74 0 41 2.2 0 0 \N \N \N \N
83078 21731 194 211 44 74 0 41 1.95 0 0 \N \N \N \N
83079 21731 335 348 44 74 0 41 2.15 0 0 \N \N \N \N
83080 21731 637 664 44 74 0 41 1.89 0 0 \N \N \N \N
83081 21731 839 849 44 74 0 41 1.87 0 0 \N \N \N \N
83082 21732 33 61 44 74 0 41 2.68 0 0 \N \N \N \N
83083 21732 161 178 44 74 0 41 1.83 0 0 \N \N \N \N
83084 21732 375 396 44 74 0 41 1.93 0 0 \N \N \N \N
116160 21732 92 102 42 72 0 41 0 0 0 \N \N \N \N
130113 21732 235 252 41 71 0 41 3 0 0 \N \N \N \N
83085 21735 76 95 44 74 0 41 2.54 0 0 \N \N \N \N
83086 21735 104 122 44 74 0 41 2.65 0 0 \N \N \N \N
83087 21736 5 20 44 74 0 41 1.92 0 0 \N \N \N \N
83088 21737 47 65 44 74 0 41 2.35 0 0 \N \N \N \N
83089 21737 72 83 44 74 0 41 1.65 0 0 \N \N \N \N
83090 21737 110 125 44 74 0 41 2.42 0 0 \N \N \N \N
83091 21737 142 154 44 74 0 41 2.16 0 0 \N \N \N \N
83092 21737 166 177 44 74 0 41 2.08 0 0 \N \N \N \N
83093 21737 565 576 44 74 0 41 1.96 0 0 \N \N \N \N
116161 21737 309 316 42 72 0 41 0 0 0 \N \N \N \N
116162 21737 643 655 42 72 0 41 0 0 0 \N \N \N \N
217810 21737 223 296 49 79 87 41 121 1.5e-33 0 \N \N \N \N
217811 21737 576 849 49 79 418 41 -74 0.0000085 0 \N \N \N \N
242841 21737 573 848 71 101 0 41 0 3e-50 0 \N \N \N \N
242842 21737 216 351 71 101 0 41 0 1.2e-41 0 \N \N \N \N
27455 21738 193 213 45 75 0 41 0 0 0 \N \N \N \N
83094 21738 256 267 44 74 0 41 2.12 0 0 \N \N \N \N
130115 21738 14 116 41 71 0 41 8.92 0 0 \N \N \N \N
217326 21738 15 117 49 79 106 41 28 0.000015 0 \N \N \N \N
217327 21738 210 257 49 79 56 41 106 4.7e-29 0 \N \N \N \N
242845 21738 13 115 71 101 0 41 0 3e-17 0 \N \N \N \N
83095 21739 44 56 44 74 0 41 2.19 0 0 \N \N \N \N
130117 21739 144 201 41 71 0 41 9.7 0 0 \N \N \N \N
217297 21739 141 168 49 79 29 41 4.4 1.7 0 \N \N \N \N
217298 21739 176 204 49 79 29 41 12.7 0.15 0 \N \N \N \N
242846 21739 117 207 71 101 0 41 0 0.0000000004 0 \N \N \N \N
242847 21739 118 208 71 101 Q86UU9 8409 0 0.0000000004 0 \N \N MD:Z:35^VIVALE31^GRPLIQPRRKKAYQLEHTFQGLLGKRSLFTE10 mdtag
\ No newline at end of file
1 2 21717 46 162035 67 162035 ENSS00000000001 1 2018-05-14 12:00:00 2018-05-14 12:00:00
2 2 21717 7 \N 28 \N ENSS00000000002 1 2018-05-21 17:00:00 2018-05-21 17:00:00
1 10 Placeholder
1 22 3
2 10 Placeholder
2 22 5
1 generic generic Generic mature RNA
2 miRNA microRNA Mature microRNA strand
3 circRNA Circular RNA \N
131538 20 4 64444167
368744 AL359765.6.1.13780 4 13780
317101 AL031658.11.1.162976 4 162976
339816 AL353092.6.1.25010 4 25010
......
1 469283 alt_20 \N
2 469283 anoth_20 4200
3 469293 chrx 11000
4 469272 chr10 11000
5 469271 chr1 11000
......@@ -181,5 +181,7 @@
103296 2 U24166 U24166 1 description D
103297 3 AAC09471 AAC09471 1 description D
103298 3 CAB53072 CAB53072 1 description D
123456 3300 MIMAT0000416 hsa-miR-1-3p 1 description D
123457 3300 MIMAT0031892 hsa-miR-1-5p 1 description D
999998 11 IPR000001 IPR000001 1 Test interpro desc1 D
999999 11 IPR000010 IPR000010 1 Test interpro desc2 D
4 31033 takifugu_rubripes FUGU4 2007-11-Ensembl 0 1 \N \N \N \N 24 \N
27 51511 ciona_savignyi CSAV2.0 2006-04-Ensembl 0 1 \N \N \N \N 39 \N
31 9544 macaca_mulatta MMUL_1 2006-01-Ensembl 1 1 \N \N \N \N 40 \N
4 31033 takifugu_rubripes FUGU4 2007-11-Ensembl 0 0 \N \N \N \N 24 \N
27 51511 ciona_savignyi CSAV2.0 2006-04-Ensembl 0 0 \N \N \N \N 39 \N
31 9544 macaca_mulatta MMUL_1 2006-01-Ensembl 1 0 \N \N \N \N 40 \N
33 9371 echinops_telfairi TENREC 2006-01-Ensembl 0 0 \N \N \N \N 40 \N
36 69293 gasterosteus_aculeatus BROADS1 2006-06-Ensembl 1 1 \N \N \N \N 40 \N
37 8090 oryzias_latipes MEDAKA1 2006-05-Ensembl 1 1 \N \N \N \N 41 \N
37 8090 oryzias_latipes MEDAKA1 2006-05-Ensembl 1 0 \N \N \N \N 41 \N
43 9258 ornithorhynchus_anatinus OANA5 2007-01-Ensembl 1 1 \N \N \N \N 42 \N
46 13616 monodelphis_domestica BROADO5 2007-02-Ensembl 1 1 \N \N \N \N 44 \N
46 13616 monodelphis_domestica BROADO5 2007-02-Ensembl 1 0 \N \N \N \N 44 \N
48 37347 tupaia_belangeri TREESHREW 2006-10-Ensembl 0 0 \N \N \N \N 43 \N
49 9365 erinaceus_europaeus HEDGEHOG 2006-10-Ensembl 0 0 \N \N \N \N 43 \N
55 42254 sorex_araneus COMMON_SHREW1 2007-04-Ensembl 0 0 \N \N \N \N 45 \N
......@@ -14,7 +14,7 @@
61 9796 equus_caballus EquCab2 2007-09-Ensembl 1 1 \N \N \N \N 49 \N
65 99883 tetraodon_nigroviridis TETRAODON8 2007-11-Ensembl 1 1 \N \N \N \N 50 \N
67 9978 ochotona_princeps pika 2008-01-Ensembl 0 0 \N \N \N \N 50 \N
69 10141 cavia_porcellus cavPor3 2008-03-Ensembl 0 1 \N \N \N \N 51 \N
69 10141 cavia_porcellus cavPor3 2008-03-Ensembl 0 0 \N \N \N \N 51 \N
78 9358 choloepus_hoffmanni choHof1 2008-11-Ensembl 0 0 \N \N \N \N 53 \N
79 9813 procavia_capensis proCap1 2008-11-Ensembl 0 0 \N \N \N \N 53 \N
80 9739 tursiops_truncatus turTru1 2008-11-Ensembl 0 0 \N \N \N \N 53 \N
......@@ -24,46 +24,46 @@
85 132908 pteropus_vampyrus pteVam1 2008-11-Ensembl 0 0 \N \N \N \N 53 \N
87 59729 taeniopygia_guttata taeGut3.2.4 2008-08-Ensembl 1 1 \N \N \N \N 53 \N
91 9315 macropus_eugenii Meug_1.0 2009-02-Ensembl 0 0 \N \N \N \N 55 \N
98 9785 loxodonta_africana loxAfr3 2009-07-Ensembl 0 1 \N \N \N \N 57 \N
98 9785 loxodonta_africana loxAfr3 2009-07-Ensembl 0 0 \N \N \N \N 57 \N
108 9986 oryctolagus_cuniculus OryCun2.0 2009-11-Ensembl 1 1 \N \N \N \N 60 \N
109 9646 ailuropoda_melanoleuca ailMel1 2010-01-Ensembl 0 1 \N \N \N \N 60 \N
111 28377 anolis_carolinensis AnoCar2.0 2010-09-Ensembl 1 1 \N \N \N \N 61 \N
109 9646 ailuropoda_melanoleuca ailMel1 2010-01-Ensembl 0 0 \N \N \N \N 60 \N
111 28377 anolis_carolinensis AnoCar2.0 2010-09-Ensembl 1 0 \N \N \N \N 61 \N
112 9103 meleagris_gallopavo UMD2 2010-09-Ensembl 1 1 \N \N \N \N 61 \N
115 61853 nomascus_leucogenys Nleu1.0 2010-10-Ensembl 0 1 \N \N \N \N 62 \N
116 8364 xenopus_tropicalis JGI_4.2 2010-09-Ensembl 0 1 \N \N \N \N 62 \N
117 9483 callithrix_jacchus C_jacchus3.2.1 2010-02-Ensembl 1 1 \N \N \N \N 63 \N
118 59463 myotis_lucifugus Myoluc2.0 2010-12-Ensembl 0 1 \N \N \N \N 63 \N
120 7757 petromyzon_marinus Pmarinus_7.0 2011-02-Ensembl 0 1 \N \N \N \N 64 \N
121 9305 sarcophilus_harrisii DEVIL7.0 2011-03-Ensembl 0 1 \N \N \N \N 64 \N
115 61853 nomascus_leucogenys Nleu1.0 2010-10-Ensembl 0 0 \N \N \N \N 62 \N
116 8364 xenopus_tropicalis JGI_4.2 2010-09-Ensembl 0 0 \N \N \N \N 62 \N
117 9483 callithrix_jacchus C_jacchus3.2.1 2010-02-Ensembl 1 0 \N \N \N \N 63 \N
118 59463 myotis_lucifugus Myoluc2.0 2010-12-Ensembl 0 0 \N \N \N \N 63 \N
120 7757 petromyzon_marinus Pmarinus_7.0 2011-02-Ensembl 0 0 \N \N \N \N 64 \N
121 9305 sarcophilus_harrisii DEVIL7.0 2011-03-Ensembl 0 0 \N \N \N \N 64 \N
122 9913 bos_taurus UMD3.1 2011-04-Ensembl 1 1 \N \N \N \N 64 \N
123 9595 gorilla_gorilla gorGor3.1 2009-08-Ensembl 1 0 \N \N \N \N 64 \N
124 30611 otolemur_garnettii OtoGar3 2011-06-Ensembl 0 1 \N \N \N \N 65 \N
125 9598 pan_troglodytes CHIMP2.1.4 2011-05-Ensembl 1 1 \N \N \N \N 65 \N
124 30611 otolemur_garnettii OtoGar3 2011-06-Ensembl 0 0 \N \N \N \N 65 \N
125 9598 pan_troglodytes CHIMP2.1.4 2011-05-Ensembl 1 0 \N \N \N \N 65 \N
126 8049 gadus_morhua gadMor1 2010-01-Ensembl 0 0 \N \N \N \N 65 \N
127 4932 saccharomyces_cerevisiae R64-1-1 2011-09-SGD 1 1 \N \N \N \N 65 \N
128 7719 ciona_intestinalis KH 2011-08-Ensembl 1 1 \N \N \N \N 66 \N
129 7897 latimeria_chalumnae LatCha1 2011-09-Ensembl 0 1 \N \N \N \N 66 \N
130 8128 oreochromis_niloticus Orenil1.0 2011-05-Ensembl 0 1 \N \N \N \N 67 \N
131 43179 ictidomys_tridecemlineatus spetri2 2011-12-Ensembl 0 1 \N \N \N \N 67 \N
132 9823 sus_scrofa Sscrofa10.2 2011-09-Ensembl 1 1 \N \N \N \N 67 \N
134 10090 mus_musculus GRCm38 2012-01-Ensembl 1 1 \N \N \N \N 68 \N
128 7719 ciona_intestinalis KH 2011-08-Ensembl 1 0 \N \N \N \N 66 \N
129 7897 latimeria_chalumnae LatCha1 2011-09-Ensembl 0 0 \N \N \N \N 66 \N
130 8128 oreochromis_niloticus Orenil1.0 2011-05-Ensembl 0 0 \N \N \N \N 67 \N
131 43179 ictidomys_tridecemlineatus spetri2 2011-12-Ensembl 0 0 \N \N \N \N 67 \N
132 9823 sus_scrofa Sscrofa10.2 2011-09-Ensembl 1 0 \N \N \N \N 67 \N
134 10090 mus_musculus GRCm38 2012-01-Ensembl 1 0 \N \N \N \N 68 \N
135 9615 canis_familiaris CanFam3.1 2011-11-Ensembl 1 1 \N \N \N \N 68 \N
136 13735 pelodiscus_sinensis PelSin_1.0 2011-11-Ensembl 0 1 \N \N \N \N 68 \N
137 8083 xiphophorus_maculatus Xipmac4.4.2 2012-01-Ensembl 0 1 \N \N \N \N 69 \N
138 9669 mustela_putorius_furo MusPutFur1.0 2012-04-Ensembl 0 1 \N \N \N \N 69 \N
139 9685 felis_catus Felis_catus_6.2 2011-12-Ensembl 1 1 \N \N \N \N 70 \N
142 9031 gallus_gallus Galgal4 2011-12-Ensembl 1 1 \N \N \N \N 71 \N
136 13735 pelodiscus_sinensis PelSin_1.0 2011-11-Ensembl 0 0 \N \N \N \N 68 \N
137 8083 xiphophorus_maculatus Xipmac4.4.2 2012-01-Ensembl 0 0 \N \N \N \N 69 \N
138 9669 mustela_putorius_furo MusPutFur1.0 2012-04-Ensembl 0 0 \N \N \N \N 69 \N
139 9685 felis_catus Felis_catus_6.2 2011-12-Ensembl 1 0 \N \N \N \N 70 \N
142 9031 gallus_gallus Galgal4 2011-12-Ensembl 1 0 \N \N \N \N 71 \N
143 6239 caenorhabditis_elegans WBcel235 2014-09-WormBase 1 1 \N \N \N \N 71 \N
144 8839 anas_platyrhynchos BGI_duck_1.0 2009-09-Ensembl 0 1 \N \N \N \N 73 \N
145 59894 ficedula_albicollis FicAlb_1.4 2012-05-Ensembl 0 1 \N \N \N \N 73 \N
146 7994 astyanax_mexicanus AstMex102 2013-04-Ensembl 0 1 \N \N \N \N 74 \N
144 8839 anas_platyrhynchos BGI_duck_1.0 2009-09-Ensembl 0 0 \N \N \N \N 73 \N
145 59894 ficedula_albicollis FicAlb_1.4 2012-05-Ensembl 0 0 \N \N \N \N 73 \N
146 7994 astyanax_mexicanus AstMex102 2013-04-Ensembl 0 0 \N \N \N \N 74 \N
147 9940 ovis_aries Oar_v3.1 2012-12-Ensembl 1 1 \N \N \N \N 74 \N
148 7918 lepisosteus_oculatus LepOcu1 2012-01-Ensembl 1 1 \N \N \N \N 74 \N
149 9361 dasypus_novemcinctus Dasnov3.0 2013-06-Ensembl 0 1 \N \N \N \N 74 \N
150 9606 homo_sapiens NCBI33 2014-01-Ensembl 1 1 \N \N \N \N 76 \N
151 9555 papio_anubis PapAnu2.0 2013-01-Ensembl 1 1 \N \N \N \N 76 \N
152 48698 poecilia_formosa PoeFor_5.1.2 2013-11-Ensembl 0 1 \N \N \N \N 76 \N
149 9361 dasypus_novemcinctus Dasnov3.0 2013-06-Ensembl 0 0 \N \N \N \N 74 \N
150 9606 homo_sapiens NCBI33 2014-01-Ensembl 1 0 \N \N \N \N 76 \N
151 9555 papio_anubis PapAnu2.0 2013-01-Ensembl 1 0 \N \N \N \N 76 \N
152 48698 poecilia_formosa PoeFor_5.1.2 2013-11-Ensembl 0 0 \N \N \N \N 76 \N
153 60711 chlorocebus_sabaeus ChlSab1.1 2014-03-Ensembl 1 1 \N \N \N \N 77 \N
154 7955 danio_rerio GRCz10 2014-09-Ensembl 1 1 \N \N \N \N 80 \N
154 7955 danio_rerio GRCz10 2014-09-Ensembl 1 0 \N \N \N \N 80 \N
155 10116 rattus_norvegicus Rnor_6.0 2014-09-Ensembl 1 1 \N \N \N \N 80 \N
156 7227 drosophila_melanogaster BDGP6 2014-05-FlyBase 1 1 \N \N \N \N 79 \N
36 \N schema_version 90
65 \N schema_version 99
2 \N schema_type compara
3 \N patch patch_84_85_a.sql|schema_version
4 \N patch patch_84_85_b.sql|gene_tree_root_attr
......@@ -35,3 +35,22 @@
40 \N patch patch_89_90_d.sql|genomic_align_tree_left_node_id_null
41 \N patch patch_89_90_e.sql|seq_member_projection
42 \N patch patch_89_90_f.sql|gene_member_missing_biotype_groups
43 \N patch patch_90_91_b.sql|gene_member_qc.seq_member_id.unsigned
45 \N patch patch_90_91_a.sql|schema_version
46 \N patch patch_90_91_c.sql|gene_member.biotype_group-index
48 \N patch patch_91_92_a.sql|schema_version
49 \N patch patch_91_92_b.sql|mapping_session_new_type_hmm
50 \N patch patch_91_92_c.sql|gene_tree_root_tag_255
52 \N patch patch_92_93_a.sql|schema_version
54 \N patch patch_93_94_a.sql|schema_version
55 \N patch patch_93_94_b.sql|homology_description_not_null
56 \N patch patch_93_94_c.sql|method_link_display_name
58 \N patch patch_94_95_a.sql|schema_version
59 \N patch patch_94_95_b.sql|remove_unused_indices
60 \N patch patch_94_95_c.sql|genome_db_is_good_for_alignment
61 \N patch patch_94_95_d.sql|node_type_within_species_speciation
62 \N patch patch_95_96_a.sql|schema_version
64 \N patch patch_96_97_a.sql|schema_version
66 \N patch patch_97_98_a.sql|schema_version
67 \N patch patch_97_98_b.sql|division_name
68 \N patch patch_98_99_a.sql|schema_version
401 PROTEIN_TREES ProteinTree.protein_tree_node
201 ENSEMBL_ORTHOLOGUES Homology.homology
202 ENSEMBL_PARALOGUES Homology.homology
402 NC_TREES NCTree.nc_tree_node
101 SYNTENY SyntenyRegion.synteny
16 LASTZ_NET GenomicAlignBlock.pairwise_alignment
401 PROTEIN_TREES ProteinTree.protein_tree_node Protein-trees
201 ENSEMBL_ORTHOLOGUES Homology.homology Orthologues
202 ENSEMBL_PARALOGUES Homology.homology Paralogues
402 NC_TREES NCTree.nc_tree_node ncRNA-trees
101 SYNTENY SyntenyRegion.synteny Synteny
16 LASTZ_NET GenomicAlignBlock.pairwise_alignment LastZ
......@@ -24,8 +24,8 @@ CREATE TABLE `conservation_score` (
`genomic_align_block_id` bigint(20) unsigned NOT NULL,
`window_size` smallint(5) unsigned NOT NULL,
`position` int(10) unsigned NOT NULL,
`expected_score` blob,
`diff_score` blob,
`expected_score` blob DEFAULT NULL,
`diff_score` blob DEFAULT NULL,
KEY `genomic_align_block_id` (`genomic_align_block_id`,`window_size`)
) ENGINE=MyISAM DEFAULT CHARSET=latin1 MAX_ROWS=15000000 AVG_ROW_LENGTH=841;
......@@ -36,34 +36,32 @@ CREATE TABLE `constrained_element` (
`dnafrag_end` int(12) unsigned NOT NULL,
`dnafrag_strand` int(2) NOT NULL,
`method_link_species_set_id` int(10) unsigned NOT NULL,
`p_value` double NOT NULL DEFAULT '0',
`score` double NOT NULL DEFAULT '0',
`p_value` double NOT NULL DEFAULT 0,
`score` double NOT NULL DEFAULT 0,
KEY `dnafrag_id` (`dnafrag_id`),
KEY `constrained_element_id_idx` (`constrained_element_id`),
KEY `mlssid_idx` (`method_link_species_set_id`),
KEY `mlssid_dfId_dfStart_dfEnd_idx` (`method_link_species_set_id`,`dnafrag_id`,`dnafrag_start`,`dnafrag_end`),
KEY `mlssid_dfId_idx` (`method_link_species_set_id`,`dnafrag_id`)
KEY `mlssid_dfId_dfStart_dfEnd_idx` (`method_link_species_set_id`,`dnafrag_id`,`dnafrag_start`,`dnafrag_end`)
) ENGINE=MyISAM DEFAULT CHARSET=latin1;
CREATE TABLE `dnafrag` (
`dnafrag_id` bigint(20) unsigned NOT NULL AUTO_INCREMENT,
`length` int(11) NOT NULL DEFAULT '0',
`length` int(11) NOT NULL DEFAULT 0,
`name` varchar(255) NOT NULL DEFAULT '',
`genome_db_id` int(10) unsigned NOT NULL,
`coord_system_name` varchar(40) NOT NULL DEFAULT '',
`cellular_component` enum('NUC','MT','PT') NOT NULL DEFAULT 'NUC',
`is_reference` tinyint(1) NOT NULL DEFAULT '1',
`codon_table_id` tinyint(2) unsigned NOT NULL DEFAULT '1',
`is_reference` tinyint(1) NOT NULL DEFAULT 1,
`codon_table_id` tinyint(2) unsigned NOT NULL DEFAULT 1,
PRIMARY KEY (`dnafrag_id`),
UNIQUE KEY `name` (`genome_db_id`,`name`)
) ENGINE=MyISAM AUTO_INCREMENT=14026981 DEFAULT CHARSET=latin1;
CREATE TABLE `dnafrag_region` (
`synteny_region_id` int(10) unsigned NOT NULL DEFAULT '0',
`dnafrag_id` bigint(20) unsigned NOT NULL DEFAULT '0',
`dnafrag_start` int(10) unsigned NOT NULL DEFAULT '0',
`dnafrag_end` int(10) unsigned NOT NULL DEFAULT '0',
`dnafrag_strand` tinyint(4) NOT NULL DEFAULT '0',
`synteny_region_id` int(10) unsigned NOT NULL DEFAULT 0,
`dnafrag_id` bigint(20) unsigned NOT NULL DEFAULT 0,
`dnafrag_start` int(10) unsigned NOT NULL DEFAULT 0,
`dnafrag_end` int(10) unsigned NOT NULL DEFAULT 0,
`dnafrag_strand` tinyint(4) NOT NULL DEFAULT 0,
KEY `synteny` (`synteny_region_id`,`dnafrag_id`),
KEY `synteny_reversed` (`dnafrag_id`,`synteny_region_id`)
) ENGINE=MyISAM DEFAULT CHARSET=latin1;
......@@ -74,7 +72,7 @@ CREATE TABLE `exon_boundaries` (
`dnafrag_start` int(11) NOT NULL,
`dnafrag_end` int(11) NOT NULL,
`sequence_length` int(10) unsigned NOT NULL,