Skip to content
Snippets Groups Projects
Commit e58730a7 authored by Karyn Megy's avatar Karyn Megy
Browse files

New Xrefs parser for Aedes aegypti (CAP annotation)

parent 96d75e7d
No related branches found
No related tags found
No related merge requests found
package XrefParser::AedesCAPParser;
use strict;
use File::Basename;
use base qw( XrefParser::BaseParser );
# Aedes CAP database dump - FASTA format
# >...
#
#
#
# Anopheles one:
# >ANXB10B|Annexin B10B
# MSWYYTPHPTVVPAEDFDASADANALRKAMKGFGTDEQAIIDILCARSNGQRQEIAEAFKRELGRDLIDDLKSELGGKFEDVILGLMLRPEAYLCKQLHKAMDGIGTDEKSLIEII
# CPQTNDQIRAIVDCYEEMYSRPLAEHLCSETSGSFRRLLTMIIVGSRDPQGTVDPELAVEQAKQLYDAGEGKLGTDEEVFYKILAHASFDQLEIVFEEYKSLSGRTIEQALKAELS
# GELYDALSAIVECVQMAPHFFAKRLHKAMDGVGTDDATLIRIIVSRSEIDLQNIKDEFEQMYNKTLVSAVRSETSGDYKRALCALIGNA
sub run {
my $self = shift if (defined(caller(1)));
my $source_id = shift;
my $species_id = shift;
my $files = shift;
my $release_file = shift;
my $verbose = shift;
my $file = @{$files}[0];
next if (/^File:/); # skip header
my @xrefs;
local $/ = "\n>";
my $file_io = $self->get_filehandle($file);
if ( !defined $file_io ) {
print STDERR "Could not open $file\n";
return 1;
}
while ( $_ = $file_io->getline() ) {
my $xref;
my ($header, $sequence) = $_ =~ /^>?(.+?)\n([^>]*)/s or warn("Can't parse FASTA entry: $_\n");
# deconstruct header - just use first part
my ($accession, $symbol, $description, $chr, $start, $end) = split /\|/, $header;
if ($symbol eq "") { $symbol = "$accession" ; }
# make sequence into one long string
$sequence =~ s/\n//g;
# build the xref object and store it
$xref->{ACCESSION} = $accession;
$xref->{LABEL} = $symbol;
$xref->{DESCRIPTION} = $description;
$xref->{SEQUENCE} = $sequence;
$xref->{SOURCE_ID} = $source_id;
$xref->{SPECIES_ID} = $species_id;
$xref->{SEQUENCE_TYPE} = 'peptide';
$xref->{STATUS} = 'manual annotation';
push @xrefs, $xref;
}
$file_io->close();
XrefParser::BaseParser->upload_xref_object_graphs(\@xrefs);
print scalar(@xrefs) . " Aedes CAP xrefs succesfully parsed\n" if($verbose);
return 0;
}
1;
0% or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment